DPCfam | MC352337
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Residues in low-complexity regions (%) | 4.77 |
| Residues in coiled-coil regions (%) | 0.57 |
| Predicted disordered residues (%) | 15.83 |
| Average transmembrane regions | 0.21 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A147BGN7 | 327-422 | 96 | LLSVWGDKTFIKHQSEQQQKYLTSALMICTGHLKLHHCTNTERDALMPKLLHGVQSHIESPEEWVRTYGMVVAEQLSKVLQPEGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZQ30-F1 | 332-434 | 88.89 | 91.53 | View in AlphaFoldDB ↗ |