DPCfam | MC352305
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Residues in low-complexity regions (%) | 3.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.06 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08443 |
| Sequences matching dominant architecture (%) | 65.56 |
| Average overlap percent | 28.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4RSQ3 | 404-486 | 83 | ATEGGFRAFSFENAPQDVLDIGVRSARLIGDGLYGVDIKQNADGVFVIEVNDNPNMEHGVEDAVEKDRVWSRLAKWFHDRLDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2G0-F1 | 409-490 | 98.80 | 94.85 | View in AlphaFoldDB ↗ |