DPCfam | MC352179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Residues in low-complexity regions (%) | 0.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.44 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000626BCAF | 32-149 | 118 | ICLSAFCELHGRKLLAFTTENTDLILHYRREAKSPSILKRVLWFQNLRKTITALCFDPSGSWLLAASIDGSLHIIPALALVDESL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VAG5-F1 | 23-125 | 87.72 | 78.75 | View in AlphaFoldDB ↗ |