DPCfam | MC351909
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06521 |
| Sequences matching dominant architecture (%) | 97.73 |
| Average overlap percent | 86.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A072UGS4 | 18-133 | 116 | IHASLAEMVCEDLPKEVCTFSVASSGKRCLLETQKGVNGEIEYQCRTSEVIVERISEYIETDQCVEACGVDRSSVGISSDAFFEP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1J747-F1 | 10-152 | 97.95 | 88.55 | View in AlphaFoldDB ↗ |