DPCfam | MC351504
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 556 ± 82 aa |
| Residues in low-complexity regions (%) | 5.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.46 |
| Average transmembrane regions | 0.71 |
| Dominant Pfam architecture(s) | PF12505 |
| Sequences matching dominant architecture (%) | 14.6 |
| Average overlap percent | 12.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H2SNL6 | 20-649 | 630 | KGRAIAEDASETTPLLATSTSSLVRDDIPVSGGSSRRRLYLLLSTVFFTTLCVCVIALLVVIFLAYSYSSKVTNVAPERLLDRAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WC57-F1 | 70-583 | 99.44 | 84.02 | View in AlphaFoldDB ↗ |