DPCfam | MC351430
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 302 ± 61 aa |
| Residues in low-complexity regions (%) | 5.24 |
| Residues in coiled-coil regions (%) | 6.09 |
| Predicted disordered residues (%) | 39.22 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K3ZBW4 | 54-334 | 281 | DTTECSSSFGDSGFASDDDTESDAGIMEVESPLYSHINVHDTPAASHIVRKKKVTADWRKFIGPERWRCQWLELRMNDLLSQVAK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0J6E8-F1 | 26-358 | 100.00 | 62.38 | View in AlphaFoldDB ↗ |