DPCfam | MC351127
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Residues in low-complexity regions (%) | 11.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04398 |
| Sequences matching dominant architecture (%) | 95.56 |
| Average overlap percent | 27.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A103XPB3 | 147-211 | 65 | IIVFTFSILLLSTFAISSLLDAADNGGNDNFTAYQVIQSYGFPKGIIPIGVIGYELDKPTGSYDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7TZ89-F1 | 6-68 | 95.24 | 77.22 | View in AlphaFoldDB ↗ |