DPCfam | MC350759
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2831 |
|---|---|
| Mean domain length (aa) | 242 ± 45 aa |
| Residues in low-complexity regions (%) | 3.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.62 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00850 |
| Sequences matching dominant architecture (%) | 94.27 |
| Average overlap percent | 82.98 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8I3R2 | 49-311 | 263 | PRPATVEDLSRAHAGYYIDLVARISQTGVATHGIERLGLGTEDNPVFLGMHDAAGLIVGGSLTAAEAIVGGRVRHAANLAGGLHH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8W4B7-F1 | 152-370 | 96.83 | 98.59 | View in AlphaFoldDB ↗ |