DPCfam | MC350620
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 257 ± 24 aa |
| Residues in low-complexity regions (%) | 4.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 73.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N1HW95 | 99-297 | 199 | TRSRSKVETQATWQAGDTGAVDFSSWNPAGDSEPVAYSPTQRTQRHTQFPESQRFLQTPATAGRKRPHDGSSASVAKRPQLRSKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DQA0-F1 | 108-360 | 98.05 | 49.16 | View in AlphaFoldDB ↗ |