DPCfam | MC350562
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00665 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 17.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M3AE12 | 1-83 | 83 | MLKTMPGIMAVTIFETLQEEFSPDAVPDTVRRTLERRVADWQAFNGADKEVFFPQRHEPGQQAQSDFTVADALGVTIGGEPFP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55501-F1 | 60-165 | 100.00 | 88.73 | View in AlphaFoldDB ↗ |