DPCfam | MC350450
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 452 ± 27 aa |
| Residues in low-complexity regions (%) | 1.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.63 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H1CBW0 | 51-533 | 483 | YTIQEIRTFIRNPMANIESIRNLAHWAYYSNGVVASGIDYMRTMHTLDGVIVSRSKRADGKRPRNYRMNKQKMEATLHTIRYKQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31953-F1 | 45-497 | 99.55 | 83.93 | View in AlphaFoldDB ↗ |