DPCfam | MC35030
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02666 |
| Sequences matching dominant architecture (%) | 2.07 |
| Average overlap percent | 0.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3NI30 | 418-570 | 153 | VASLATIRHDFNPKKEKCPNCHKIDKRNSSALQHLSMCTLDLKPKQFLHKHYTTSNNASRRWYSKVLAHIAYGRLTVGGNNAHIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q3E7-F1 | 741-904 | 98.80 | 69.15 | View in AlphaFoldDB ↗ |