DPCfam | MC35000
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 490 ± 41 aa |
| Residues in low-complexity regions (%) | 1.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11175 |
| Sequences matching dominant architecture (%) | 67.94 |
| Average overlap percent | 48.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3SUI3 | 48-429 | 382 | RIGGQDYRVLFHDRGEGRIARLWMTTAKEKIDTQYQELWVELDGITVFKGRPRDFFEGRGPWKAPLVLDWQQSSGAFTSYVPFAW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PN95-F1 | 95-365 | 52.60 | 97.26 | View in AlphaFoldDB ↗ |