DPCfam | MC349852
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Residues in low-complexity regions (%) | 3.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.51 |
| Average transmembrane regions | 0.17 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G3HE05 | 117-242 | 126 | VAINMAIGMVVTSLTMEPPRPTAAQQMQSLAAPSPTYTLQAQGNQARLGQPIPEHFGRHRSFPDFGAEPYAEYVGNEQFLYQLFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZQ83-F1 | 134-193 | 46.15 | 54.06 | View in AlphaFoldDB ↗ |