DPCfam | MC349761
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 178 ± 25 aa |
| Residues in low-complexity regions (%) | 18.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 63.44 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X1WGY4 | 647-820 | 174 | VQSPPNVGLRRSGQVEGVRQMHQNAPRSQMATERDLQAWRRRVVIPELTPSGYRAQESFRIAKGDEEVNLYNTKKRRVTHSTFRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A2AHJ4-F1 | 696-873 | 100.00 | 43.79 | View in AlphaFoldDB ↗ |