DPCfam | MC34968
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Residues in low-complexity regions (%) | 0.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15794 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 60.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A8EVS8 | 2-82 | 81 | KTLSKAFQKHGIDRNTVVSTASVAELAIAAPLVYQELISNKPSGETVLHFAKRCEEEIQGNDEMKNKIESMKADGTLLPIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9BWC9-F1 | 174-274 | 99.03 | 91.29 | View in AlphaFoldDB ↗ |