DPCfam | MC34933
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Residues in low-complexity regions (%) | 4.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.48 |
| Average transmembrane regions | 1.75 |
| Dominant Pfam architecture(s) | PF02028 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.12 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6W2K9 | 145-231 | 87 | AMRVAIFHWGLHGWALFAVIGLALAYFSYRKGLPLSIRSSLHPIFGDRIYGPIGHAADLLAVFGTVFGIATSLGLGAQQMNAGLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54417-F1 | 129-209 | 98.78 | 95.78 | View in AlphaFoldDB ↗ |