DPCfam | MC349235
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Residues in low-complexity regions (%) | 13.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.1 |
| Average transmembrane regions | 1.32 |
| Dominant Pfam architecture(s) | PF09775 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 60.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4WH27 | 25-89 | 65 | AVNSGMSFMLSSILVVLLFSGMQMYKVLLSSSQLGTILGGLIGSLLFMCTLTAVGNLESTLFGKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P86229-F1 | 1-74 | 100.00 | 87.84 | View in AlphaFoldDB ↗ |