DPCfam | MC34902
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.02 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12298 |
| Sequences matching dominant architecture (%) | 96.97 |
| Average overlap percent | 57.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U5HHL5 | 98-209 | 112 | DGAQYRRGIKGATNWIGETPFPLNPTFKPLPPVSELIKTKIYHAYLGNLQTNSPPSDLVVVRAISSKFGLSMARVRAIIRLKELE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W6D3-F1 | 92-203 | 94.34 | 91.86 | View in AlphaFoldDB ↗ |