DPCfam | MC349
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02384 |
| Sequences matching dominant architecture (%) | 2.47 |
| Average overlap percent | 1.06 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D1J931 | 875-967 | 93 | EECRYLFNWSRVPGNDSEKLIQFLVDVLDLGWAENATITKSVDEMSINITDDGNTATITIDENKETATVKVGDEIIYVLDVRIED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P49806-F1 | 53-117 | 65.59 | 94.11 | View in AlphaFoldDB ↗ |