DPCfam | MC348814
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Residues in low-complexity regions (%) | 1.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S7WFZ1 | 478-572 | 95 | VDYFNPVSSHSIELNLQHDWLTWREYERDFKQHFELTLGTFKQKDFAHQPVYNFLYRHDWRISRVCYLNYGVGWGSHPYDGEHED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P69434-F1 | 713-807 | 100.00 | 96.45 | View in AlphaFoldDB ↗ |