DPCfam | MC348794
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 624 ± 115 aa |
| Residues in low-complexity regions (%) | 6.77 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 28.84 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03568 |
| Sequences matching dominant architecture (%) | 27.27 |
| Average overlap percent | 35.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2AA37E | 1775-2565 | 791 | MFAESAQDSQGRHQLLMEAYGILSEATNIIDAVMSDVVSTSTLSEMRQVSLPVHRESVEVRLQLTDLMVNMFLCYSQETRIKREH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9Q2C0-F1 | 1953-2588 | 100.00 | 74.07 | View in AlphaFoldDB ↗ |