DPCfam | MC348675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06777 |
| Sequences matching dominant architecture (%) | 2.56 |
| Average overlap percent | 14.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D6J231 | 445-502 | 58 | LAIRPVFDRFETVVITSGTLSPIDLYPRLLNFNPVISRSFTMSLTRDCICPMVLTRGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JDF1-F1 | 439-497 | 100.00 | 88.69 | View in AlphaFoldDB ↗ |