DPCfam | MC34862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 412 ± 36 aa |
| Residues in low-complexity regions (%) | 1.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000551F521 | 358-908 | 551 | ITTDYVTYKMYGAKGDGKTDDYDAIVKTHAEANAKGLPVKADQGAVYYIGHMDKNNTKGALIMTETDWTGAEFIIDDSKMTLAEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GMB3-F1 | 302-734 | 95.69 | 91.09 | View in AlphaFoldDB ↗ |