DPCfam | MC348404
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 78.77 |
| Predicted disordered residues (%) | 35.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2L4H7 | 659-770 | 112 | RMEQRVRQFERMLLVDTADCRRSEDMLEKRLSKLEGVCGRLDGVSNSIHKFRDGLNQHVAGLWTYVSGLNESVIHHGGILDSLQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1LXD8-F1 | 664-781 | 95.69 | 74.99 | View in AlphaFoldDB ↗ |