DPCfam | MC348389
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Residues in low-complexity regions (%) | 4.1 |
| Residues in coiled-coil regions (%) | 13.08 |
| Predicted disordered residues (%) | 34.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11740 |
| Sequences matching dominant architecture (%) | 1.82 |
| Average overlap percent | 37.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136HGB4 | 1-92 | 92 | MTISDEISIIANKLANEGKTPTVALIKSQLSQTTPLPQIITVLKHWQHEPTFIQPKQQDKVRTASTKHTPENETIKLLINQAILP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P29770-F1 | 6-105 | 94.68 | 91.36 | View in AlphaFoldDB ↗ |