DPCfam | MC348378
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.71 |
| Predicted disordered residues (%) | 17.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C4XWT0 | 66-152 | 87 | YPAWCSDNGASVEIETIRSIFDRTALVFGFQADNSANMFEYLMSLLDSRASRMSCTSALISVHADYLGGDSSSYKKWYFAAYYDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PL67-F1 | 208-295 | 98.88 | 88.48 | View in AlphaFoldDB ↗ |