DPCfam | MC347947
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Residues in low-complexity regions (%) | 5.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.86 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF11035 |
| Sequences matching dominant architecture (%) | 95.65 |
| Average overlap percent | 50.03 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094EFC92 | 1-173 | 173 | MKPPPRTRNKPDRNLNPNPEPTQSRQPCAWSRKEQKMLLDALRRQGSSCGGGSPGNIDYSLLKKDVPSRSDSEIRSVVQRLQDKV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7F685-F1 | 1-149 | 99.33 | 79.17 | View in AlphaFoldDB ↗ |