DPCfam | MC347562
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.3 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10109 |
| Sequences matching dominant architecture (%) | 87.75 |
| Average overlap percent | 92.5 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3D4A4 | 22-108 | 87 | VTLTRPSEANGVNVETLTMRAPSVRAVRAADHASNGNDEQRELMLFAGLTEVGLKDLEGLKLTDYRRVQTAYSTLAPDTDYSTSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMV1-F1 | 8-89 | 98.67 | 96.73 | View in AlphaFoldDB ↗ |