DPCfam | MC347501
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Residues in low-complexity regions (%) | 13.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146LSY6 | 30-123 | 94 | HPLKGMSAMPSLPGKGLTKVIDRVTKTTTSVQDPLMSALDGVDPLSALAAQTDWDEYDTKKKVKEMRQKSDPWNDQKQVILSKYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7Z3J2-F1 | 6-144 | 98.54 | 50.68 | View in AlphaFoldDB ↗ |