DPCfam | MC34747
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 961 |
|---|---|
| Mean domain length (aa) | 168 ± 13 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 25.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10592 |
| Sequences matching dominant architecture (%) | 99.23 |
| Average overlap percent | 55.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A01AED3 | 236-374 | 139 | QDGNINKGLFYDNVRDFLGSENSVNKDIEGTIKSPSQRNLFSVLNNGVTLVARKVVPSGDRFEISGFQVVNGCQTSHVLFNNRDH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GQP7-F1 | 217-370 | 92.31 | 83.34 | View in AlphaFoldDB ↗ |