DPCfam | MC347358
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Residues in low-complexity regions (%) | 1.49 |
| Residues in coiled-coil regions (%) | 0.49 |
| Predicted disordered residues (%) | 19.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10798 |
| Sequences matching dominant architecture (%) | 89.0 |
| Average overlap percent | 74.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D1N2Z2 | 22-88 | 67 | ADPAFTQGDGPTCEQTLGAIVMDLLRAGEKVSKSTLCLAVVSRIETADNSDTHAHLLNVLELIIRSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7ZKT2-F1 | 13-84 | 100.00 | 95.84 | View in AlphaFoldDB ↗ |