DPCfam | MC34732
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Residues in low-complexity regions (%) | 9.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.66 |
| Average transmembrane regions | 3.43 |
| Dominant Pfam architecture(s) | PF17329 |
| Sequences matching dominant architecture (%) | 72.92 |
| Average overlap percent | 75.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003762D0D | 11-136 | 126 | GLAMWVVVTLFFMLFGDWVLVGTDDPHFGASLFLLEALTLFVLVGLSLIVRLRLFPQKGSATRLGYWAAAIGLPLNAAAIWNRGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34356-F1 | 7-99 | 75.63 | 93.98 | View in AlphaFoldDB ↗ |