DPCfam | MC34725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 187 ± 35 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 51.52 |
| Predicted disordered residues (%) | 38.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02759 |
| Sequences matching dominant architecture (%) | 2.04 |
| Average overlap percent | 39.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A132AA91 | 311-460 | 150 | EKIEQLEKTNEYLEQQNQMLKIQNECYRSKLELIEFDKKTIIDDNEQIENNFQQKLVQISEMHGEIVEFNEHLFRIIHIKNSIIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9D3S3-F1 | 494-684 | 100.00 | 74.31 | View in AlphaFoldDB ↗ |