DPCfam | MC347091
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 84 ± 15 aa |
| Residues in low-complexity regions (%) | 5.38 |
| Residues in coiled-coil regions (%) | 0.8 |
| Predicted disordered residues (%) | 23.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000498F7B7 | 1-82 | 82 | MEKLLVQIFERKKWIVNQAKQQTLLFEQHLASKCLIDGIAPPPWLCSSTDPNNVLXKQELNSGVPLRGALPVIPFSXHCSVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FM57-F1 | 48-136 | 94.74 | 66.21 | View in AlphaFoldDB ↗ |