DPCfam | MC347082
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 102 ± 19 aa |
| Residues in low-complexity regions (%) | 7.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.91 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00736 |
| Sequences matching dominant architecture (%) | 62.2 |
| Average overlap percent | 84.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0AF63 | 1-82 | 82 | MGDIACVYKVMPEDAETDLDDIKDQLRELLDVDDIGEENVAFGLKAVKASCVTTDEEGGTDAVEEKLEQLESVQSYELEHFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O70251-F1 | 125-224 | 99.02 | 82.40 | View in AlphaFoldDB ↗ |