DPCfam | MC34678
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Residues in low-complexity regions (%) | 0.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05257 |
| Sequences matching dominant architecture (%) | 10.75 |
| Average overlap percent | 69.98 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8X7J3 | 728-843 | 116 | DIDKAVDYIDSNAEPKSLSKCALYVRKAINAGGIKNISGHAYEYYDTDKLVSLGFKKIGTDIDTIQLKKGDIVAFGAVGGHSYGH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZNB5-F1 | 9-119 | 100.00 | 96.45 | View in AlphaFoldDB ↗ |