DPCfam | MC346136
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Residues in low-complexity regions (%) | 7.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.87 |
| Average transmembrane regions | 0.27 |
| Dominant Pfam architecture(s) | PF00368 |
| Sequences matching dominant architecture (%) | 99.4 |
| Average overlap percent | 27.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L9SZB4 | 344-432 | 89 | SNCMTLMKNVGGALHISVSMPSLELGTLGGGTQLEPQGAMLEVLGVRGSNATNVGENARRLARIIAAATLAGELSTCSALVTGHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q19207-F1 | 414-501 | 96.67 | 92.56 | View in AlphaFoldDB ↗ |