DPCfam | MC34568
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Residues in low-complexity regions (%) | 3.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13861 |
| Sequences matching dominant architecture (%) | 81.82 |
| Average overlap percent | 65.62 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4YYL7 | 135-230 | 96 | KVQIMDANGQAVRTLDLGAQNAGLIGFSWDGKNDQGQVMADGSYTASVAAFSGASTVPATPLTLASVSSVSLTGGAVKVNASGLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I4Q0-F1 | 136-235 | 97.98 | 94.46 | View in AlphaFoldDB ↗ |