DPCfam | MC345552
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Residues in low-complexity regions (%) | 11.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06267 |
| Sequences matching dominant architecture (%) | 96.37 |
| Average overlap percent | 34.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F5UWY1 | 135-196 | 62 | NRGPLAERLIASLRAGQQAGGDKRGQQSAALLIVKEKGGYGGFTDRLIDLRIDDHPQPIEEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HTH3-F1 | 128-199 | 98.61 | 97.57 | View in AlphaFoldDB ↗ |