DPCfam | MC345514
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 214 ± 32 aa |
| Residues in low-complexity regions (%) | 10.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.7 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16019 |
| Sequences matching dominant architecture (%) | 80.85 |
| Average overlap percent | 90.04 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9KYX1 | 42-272 | 231 | PILKRARQSVPGRVRFDGVLVYSFARCQGFTSVPSQGGCTLGMAAKHSGHRRYTLTEFSRERERRRWERMREHLRERRLEALKSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A1W4-F1 | 56-277 | 99.07 | 88.27 | View in AlphaFoldDB ↗ |