DPCfam | MC34520
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 588 ± 111 aa |
| Residues in low-complexity regions (%) | 7.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.89 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF17076 |
| Sequences matching dominant architecture (%) | 65.0 |
| Average overlap percent | 74.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6FY30 | 198-867 | 669 | TTMMSPSLALSIGSGMTRSDVITPNKYSNLDSGSLGIAETPKARYIFSNVNRNRSQSSIKSSENSSPLRFVDGPNQRRTLPGASN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7TKY1-F1 | 193-800 | 99.11 | 71.44 | View in AlphaFoldDB ↗ |