DPCfam | MC345151
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2651 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Residues in low-complexity regions (%) | 4.8 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 2.82 |
| Average transmembrane regions | 2.71 |
| Dominant Pfam architecture(s) | PF00209 |
| Sequences matching dominant architecture (%) | 95.25 |
| Average overlap percent | 59.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182ELK9 | 102-218 | 117 | SLLRDKWASKIEFLLSVVGYAVDLGNIWRFPYICYKYGGGAFLIPYLVMLCIGGLPMFYMELVLGQFHRSGCISIGFGICFICTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9MYX0-F1 | 77-192 | 98.26 | 95.35 | View in AlphaFoldDB ↗ |