DPCfam | MC345077
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 616 ± 51 aa |
| Residues in low-complexity regions (%) | 1.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.05 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L7XY64 | 125-774 | 650 | THDELDYQSSLDKPPLPGKGRLLDLDTYKQDMRLWGVMLEYRKRVYGDHGVLTFLNALTQRGVLIPTNGALADRFWVTFLDLGFR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q3D0-F1 | 170-866 | 99.84 | 77.97 | View in AlphaFoldDB ↗ |