DPCfam | MC344991
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Residues in low-complexity regions (%) | 10.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.33 |
| Average transmembrane regions | 1.63 |
| Dominant Pfam architecture(s) | PF10063 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 60.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5E335 | 94-188 | 94 | LITIDSEQLVWLPIGFLCVCFSGIALKESFCFKVIGLKAIPFLLCISILMLAIEVWLIAIICLFLSGIIFIFLAIQKWKMPLHFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q851Z3-F1 | 190-263 | 100.00 | 93.28 | View in AlphaFoldDB ↗ |