DPCfam | MC344833
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 196 ± 25 aa |
| Residues in low-complexity regions (%) | 9.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.17 |
| Average transmembrane regions | 2.34 |
| Dominant Pfam architecture(s) | PF09586 |
| Sequences matching dominant architecture (%) | 0.43 |
| Average overlap percent | 22.39 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F7RLQ6 | 371-511 | 141 | PLPYLITFYIPFLEAVRIPGRYGVMAMLFFAIIAGYALKTLFSKIRKKSILWQMLIIIIILFEYIAIPFPLISEMKIPPIYERIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EQS8-F1 | 380-513 | 66.15 | 94.79 | View in AlphaFoldDB ↗ |