DPCfam | MC344393
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 2.25 |
| Predicted disordered residues (%) | 30.61 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03126 |
| Sequences matching dominant architecture (%) | 91.94 |
| Average overlap percent | 15.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q3C6L8 | 573-692 | 120 | IPIDEISNQEFSEVIDECKRLRQSMKCGLIKSLKVGEIRDKAMTLQAIRVNDWLETEILRLSHLRDRASETGRRKDLRECVEKLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1L3P9-F1 | 241-355 | 98.29 | 86.99 | View in AlphaFoldDB ↗ |