DPCfam | MC34406
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 242 ± 34 aa |
| Residues in low-complexity regions (%) | 2.25 |
| Residues in coiled-coil regions (%) | 2.12 |
| Predicted disordered residues (%) | 10.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00989 |
| Sequences matching dominant architecture (%) | 22.46 |
| Average overlap percent | 13.52 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174PF94 | 7-256 | 250 | LGNVLIISSRKRMLSEFQSYLHSVLGEYLTFNTLLREQATDPSLFRGYQCVLFPTARAMENFPLTIDPSILQLPCDRVFNHMFLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31661-F1 | 362-429 | 27.53 | 86.36 | View in AlphaFoldDB ↗ |