DPCfam | MC343982
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 690 ± 161 aa |
| Residues in low-complexity regions (%) | 3.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.65 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00615 |
| Sequences matching dominant architecture (%) | 57.89 |
| Average overlap percent | 12.5 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091E6J2 | 11-508 | 498 | LLEKCIGGVRGMWRFCSYLKGSAGEELVDFWILAEKILSIDEMDLEVRNYYLSLLLMLKATYLQEGSRVVTLCNMNIKSLLNLCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5F8MPV0-F1 | 13-862 | 99.77 | 72.84 | View in AlphaFoldDB ↗ |