DPCfam | MC343933
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 111 ± 24 aa |
| Residues in low-complexity regions (%) | 7.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00634 |
| Sequences matching dominant architecture (%) | 3.57 |
| Average overlap percent | 9.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2LFN4 | 49-133 | 85 | DPKILKRRRALDYLSRIPSPPPLSVLDSVSSPCVKKTFNPPRRSGTANEFRTEKAIKPTDSLVEDQWVNDEELVMIDAQALHVGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C6TML1-F1 | 23-94 | 59.83 | 82.31 | View in AlphaFoldDB ↗ |